USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
$0.00
Asymmetrical Bat Sleeve top
Asymmetrical Bat Sleeve top Asymmetrical Bat Sleeve top Asymmetrical Bat Sleeve top

Asymmetrical Bat Sleeve top

Units in Stock 5
$29.82 inc. tax
$28.00 ex. tax
? Tax based on Washington, United States.
Now you can enjoy spooky season year round with the Asymmetrical Bat Sleeve top. The black fabric is trimmed with a purple border for a pop of color and features a batwing bell sleeve. Made of 100% polyester.

💜Available in various sizes.
Product Code: aQH7sBe
Product Condition: New
Related Products
Dark Parasol
Dark Parasol
$15.00
Ladies Steampunk V-Neck..
Ladies Steampunk V-Neck..
$25.00
Triple Moon Galaxy Dress
Triple Moon Galaxy Dress
$30.00
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i