USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
$0.00
Rainbow Aura Quartz Point
Rainbow Aura Quartz Point Rainbow Aura Quartz Point Rainbow Aura Quartz Point

Rainbow Aura Quartz Point

Units in Stock 3
$12.78 inc. tax
$12.00 ex. tax
? Tax based on Washington, United States.
Rainbow Aura Quartz is said to balance each chakra, stimulating Kundalini energy. This healing crystal provides insight and healing of relationship, releasing any feelings of grief,. resentment, or karmic ties.

Each crystal point measure 1.99 - 2.79 inches in height.

💙This listing is for a single Rainbow Aura Quartz.
Product Code: iDoit34
Product Condition: New
Related Products
Angel Aura Quartz Tumble
Angel Aura Quartz Tumble
$4.00
Raw Rose Quartz Crystal
Raw Rose Quartz Crystal
$5.57
Blue Kyanite Blade
Blue Kyanite Blade
$6.00
Rough Amethyst Crystal
Rough Amethyst Crystal
$6.50
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i